PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BL_17A712C94.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 679aa    MW: 73672.2 Da    PI: 6.317
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BL_17A712C94.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1031.7e-32278334259
                            --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                            +DgynWrKYGqK+vk+se+prsYY+Ct+++Cpvkkkvers+ d++++ei+Y+++Hnh+
  Traes_5BL_17A712C94.1 278 EDGYNWRKYGQKQVKSSEHPRSYYKCTHPDCPVKKKVERSQ-DGQITEIVYKSSHNHP 334
                            8****************************************.***************7 PP

2WRKY1048.1e-33490548159
                            ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                            ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC+v+k+ver+++d k v++tYeg+Hnhe
  Traes_5BL_17A712C94.1 490 LDDGYRWRKYGQKVVKGNPNPRSYYKCTHQGCSVRKHVERASHDLKSVITTYEGKHNHE 548
                            59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.9E-29268336IPR003657WRKY domain
PROSITE profilePS5081123.319272336IPR003657WRKY domain
SuperFamilySSF1182904.45E-26272336IPR003657WRKY domain
SMARTSM007747.0E-36277335IPR003657WRKY domain
PfamPF031065.0E-25278334IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.2E-37475550IPR003657WRKY domain
SuperFamilySSF1182906.41E-29482550IPR003657WRKY domain
PROSITE profilePS5081137.883485550IPR003657WRKY domain
SMARTSM007743.3E-38490549IPR003657WRKY domain
PfamPF031062.7E-25491548IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009942Biological Processlongitudinal axis specification
GO:0030010Biological Processestablishment of cell polarity
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 679 aa     Download sequence    Send to blast
MAGTSDRGSL MEDWMAMPPT PSPRTLMSSF LNEDFSSGQF SNFFGEHVSN KPHDQSEKRG  60
ELVDLREQVP AQSATDTATP QKDFSLQPNS FNANQKSNPQ GSLAERRASR AGFSIPKIDT  120
SRVGSSTVIR SPIAIPPGLS PTTLLESPVF LYNAMAQPSP TTGKLFVASE ANSTMPPDST  180
FSNDVFSFQP HSGPTSYSNV EKGYTVCHQN QSLSNIHQQG SSLQSSFTAA KDSADETIVK  240
PKTSDSVFSD NHSSEEQEDD EGDQNEEYSS ATNSNPAEDG YNWRKYGQKQ VKSSEHPRSY  300
YKCTHPDCPV KKKVERSQDG QITEIVYKSS HNHPLPPPNR RSGIPSLQIN DPQVHLLEKP  360
GLHTGVNTAS LWENGKSECI QDMQGVEGRP AAGPPVSAYG DTSIMESQDA ADVSSTLSNE  420
IDRATQGTIS LDCDVGEDET ESKRRKLDAL AAVTIPTATT TSSIDMVAAA SRAVREPRVV  480
VQTTSEVDIL DDGYRWRKYG QKVVKGNPNP RSYYKCTHQG CSVRKHVERA SHDLKSVITT  540
YEGKHNHEVP AARNSGNAGS APASAPQANL SHRRQEQAQG SYSQFGGASP FGSFGLPPRG  600
HLGAAGNFHF GMAPPGMSMP PMPAARHPSM MQGYPGLMMQ EGQMMQEGQM KAEPDQQSGF  660
AASSAYQQMM GRPPFGPQM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-36278551878Probable WRKY transcription factor 4
2lex_A4e-36278551878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00071PBMTransfer from AT5G56270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3621580.0AK362158.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2002O24.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010238285.10.0PREDICTED: probable WRKY transcription factor 2
TrEMBLW5F8110.0W5F811_WHEAT; Uncharacterized protein
STRINGMLOC_58019.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP207538100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.11e-116WRKY DNA-binding protein 2
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]